background image

48

4

    Using the Notebook PC

These are examples of the Notebook PC 

connected to a Wireless Network�

Desktop PC

PDA

Notebook PC

Access 

Point

Desktop PC

PDA

Notebook PC

Wireless LAN Connection (on selected models)

The optional built-in wireless LAN is a compact easy-to-use wireless Ethernet adapter. Implementing 

the IEEE 802.11 standard for wireless LAN (WLAN), the optional built-in wireless LAN is capable of 

fast data transmission rates using Direct Sequence Spread Spectrum (DSSS) and Orthogonal Frequency 

Division Multiplexing (OFDM) technologies on 2.4GHz/5GHz frequencies. The optional built-in wire

-

less LAN is backward compatible with the earlier IEEE 802.11 standards allowing seamless interfacing 

of wireless LAN standards.
The optional built-in wireless LAN is a client adapter that supports Infrastructure and Ad-hoc modes 

giving you flexibility on your existing or future wireless network configurations for distances up to 40 

meters between the client and the access point.

To provide efficient security to your wireless communication, the optional built-in wireless LAN comes 

with a 64-bit/128-bit Wired Equivalent Privacy (WEP) encryption and Wi-Fi Protected Access (WPA) 

features.

Ad-hoc mode

The Ad-hoc mode allows the Notebook PC to connect 

to another wireless device. No access point (AP) is 

required in this wireless environment.

(All devices must install optional 802�11 wireless LAN 

adapters�)

Infrastructure mode

The Infrastructure mode allows the Notebook PC 

and other wireless devices to join a wireless network 

created by an Access Point (AP) (sold separately) that 

provides a central link for wireless clients to com-

municate with each other or with a wired network.

(All devices must install optional 802�11 wireless LAN 

adapters�)

For security concerns, DO NOT connect 

to the unsecured network; otherwise, the 

information transmission without encryp-

tion might be visible to others.

Summary of Contents for N20A

Page 1: ...Notebook PC Hardware User s Manual E4106 September 2008 ...

Page 2: ...Using Battery Power 25 Battery Care 25 Powering ON the Notebook PC 26 The Power On Self Test POST 26 Checking Battery Power 27 Charging the Battery Pack 27 Power Options 28 Power Management Modes 29 Sleep and Hibernate 29 Thermal Power Control 29 Special Keyboard Functions 30 Colored Hot Keys 30 Microsoft Windows Keys 32 Keyboard as a Numeric Keypad 32 Keyboard as Pointers 32 Swithches and Status ...

Page 3: ...lected models 48 Windows Wireless Network Connection 49 Bluetooth Wireless Connection on selected models 50 Trusted Platform Module TPM on selected models 51 Fingerprint Registration on selected models 52 3G Watcher on selected models and in selected territories 54 Appendix Optional Accessories A 2 Optional Connections A 3 Bluetooth Mouse Setup optional A 4 Operating System and Software A 6 System...

Page 4: ... Contents ...

Page 5: ...ons Preparing your Notebook PC Photos and icons in this manual are used for artistic purposes only and do not show what is actually used in the product itself There may be differences between your Notebook PC and the drawings shown in this manual Please accept your Notebook PC as being correct ...

Page 6: ...rmation on using the Notebook PC s components 5 Appendix Introduces you to optional accessories and gives additional information Notes For This Manual A few notes and warnings in bold are used throughout this guide that you should be aware of in order to complete certain tasks safely and completely These notes have different degrees of importance as described below IMPORTANT Vital information that...

Page 7: ...e the battery DO NOT expose to strong magnetic or electrical fields DO NOT place on uneven or unstable work surfaces Seek servicing if the casing has been damaged DO NOT place or drop objects on top and do not shove any foreign objects into the Notebook PC DO NOT press or touch the display panel Do not place together with small items that may scratch or enter the Notebook PC DO NOT leave the Noteb...

Page 8: ...ronic devices Most airlines will allow electronic use only between and not during takeoffs and landings Transportation Precautions To prepare the Notebook PC for transport you should turn it OFF and disconnect all external peripher als to prevent damage to the connectors The hard disk drive s head retracts when the power is turned OFF to prevent scratching of the hard disk surface during transport...

Page 9: ...er Adapter IMPORTANT When opening do not force the display panel down to the table or else the hinges may break Never lift the Notebook PC by the display panel 3 Open the Display Panel 4 Turn ON the Notebook PC The power switch turns ON and OFF the Notebook PC or putting the Notebook PC into sleep or hiber nation modes Actual behavior of the power switch can be customized in Windows Control Panel ...

Page 10: ...10 1 Introducing the Notebook PC ...

Page 11: ...os and icons in this manual are used for artistic purposes only and do not show what is actually used in the product itself There may be differences between your Notebook PC and the drawings shown in this manual Please accept your Notebook PC as being correct ...

Page 12: ...12 2 Knowing the Parts Top Side Refer to the illustration below to identify the components on this side of the Notebook PC The keyboard will be different for each territory 3 4 5 7 8 1 2 9 6 ...

Page 13: ...mfortable travel depth at which the keys can be depressed and palm rest for both hands Two Windows function keys are provided to help ease navigation in the Windows operating system Display Panel The Notebook PC uses an active matrix TFT LCD which provides excellent viewing like that of desktop monitors Unlike traditional desktop monitors the LCD panel does not produce any radiation or flickering ...

Page 14: ...book PC while it is in operation or recently been in operation High tempera tures are normal during charging or operation Do not use on soft surfaces such as beds or sofas which may block the vents DO NOT PUT THE NOTEBOOK PC ON YOUR LAP OR OTHER PARTS OF THE BODY TO AVOID INJURY FROM THE HEAT The bottom side may vary in appearance depending on model The battery pack size will vary depending on mod...

Page 15: ...o anAC power source and maintains power to the Notebook PC when AC power is not connected This al lows use when moving temporarily between locations Battery time varies by usage and by the specifications for this Notebook PC The battery pack cannot be disassembled and must be purchased as a single unit 4 3 Central Processor Unit CPU Compartment Some Notebook PC models feature a socketed processor ...

Page 16: ...r adapter convertsAC power to DC power for use with this jack Power sup plied through this jack supplies power to the Notebook PC and charges the internal battery pack To prevent damage to the Notebook PC and battery pack always use the supplied power adapter CAUTION MAY BECOME WARM TO HOT WHEN IN USE BE SURE NOT TO COVER THE ADAPTER AND KEEP IT AWAY FROM YOUR BODY Air Vents The air vents allow co...

Page 17: ...ed all digital audio video interface between any audio video source such as a set top box DVD player andA Vreceiver and an audio and or video monitor such as a digital television DTV Supports standard enhanced or high definition video plus multi channel digital audio on a single cable It transmits allATSC HDTVstandards and supports 8 channel digital audio with bandwidth to spare to accommodate fut...

Page 18: ...e writable RW capabilities See the marketing specifica tions for details on each model Optical Drive Electronic Eject The optical drive eject has an electronic eject button for opening the tray You can also eject the optical drive tray through any software player or by right clicking the optical drive in Windows Computer and selecting Eject SPDIF Output Jack This jack provides connection to SPDIF ...

Page 19: ... scanners connected in a series up to 12Mbits sec USB 1 1 and 480Mbits sec USB 2 0 USB allows many devices to run simultaneously on a single computer with some peripherals acting as additional plug in sites or hubs USB supports hot swapping of devices so that most peripherals can be connected or disconnected without restarting the computer Kensington Lock Port The Kensington lock port allows the N...

Page 20: ...dio controller that produces rich vibrant sound results improved with external stereo headphones or speakers Audio features are software controlled 2 1 Flash Memory Slot Normally an external memory card reader must be purchased separately in order to use memory cards from devices such as digital cameras MP3 players mobile phones and PDAs This Notebook PC has a built in high speed memory card reade...

Page 21: ...monitor port supports a standard VGA compatible device such as a monitor or projector to allow viewing on a larger external display 1 1 2 LAN Port The RJ 45 LAN port with eight pins is larger than the RJ 11 modem port and supports a standard Ethernet cable for connection to a local network The built in connector allows convenient use without additional adapters 2 ...

Page 22: ...22 2 Knowing the Parts ...

Page 23: ...gement Modes Special Keyboard Functions Swithches and Status Indicators Photos and icons in this manual are used for artistic purposes only and do not show what is actually used in the product itself There may be differences between your Notebook PC and the drawings shown in this manual Please accept your Notebook PC as being correct ...

Page 24: ...most every country Power System Using AC Power The Notebook PC power is comprised of two parts the power adapter and the battery power system The power adapter convertsAC power from a wall outlet to the DC power required by the Notebook PC Your Notebook PC comes with a universal AC DC adapter That means that you may connect the power cord to any 100V 120V as well as 220V 240V outlets without setti...

Page 25: ...e battery be used in a temperature range between 5 C and 35 C 41 F and 95 F You must also take into account that the Notebook PC s internal temperature is higher than the outside temperature Any temperatures above or below this range will shorten the life of the battery But in any case the battery pack s usage time will eventually decrease and a new battery pack must be purchased from an authorize...

Page 26: ... diagnos tic tests called the Power On Self Test POST The software that controls the POST is installed as a permanent part of the Notebook PC s architecture The POST includes a record of the Notebook PC s hardware configuration which is used to make a diagnostic check of the system This record is created by using the BIOS Setup program If the POST discovers a difference between the record and the ...

Page 27: ...over the battery icon without power adapter Pointer over the battery icon with power adapter Right click the battery icon WARNING DO NOT leave the battery pack discharged The battery pack will discharge over time If not using a battery pack it must continued to be charged every three months to extend recovery capacity or else it may fail to charge in the future The battery stops charging if the te...

Page 28: ...the lock icon Restarting or Rebooting After making changes to your operating system you may be prompted to restart the system Some installation processes will provide a dialog box to allow restart To restart the system manually choose Restart IMPORTANT Do not use emergency shutdown while data is being written doing so can result in loss or destruction of your data Emergency Shutdown In case your o...

Page 29: ...re turned OFF Because RAM is volatile it requires power to keep refresh the data Click the Start button and the arrowhead next to the lock icon to see this option You can also use the keyboard shortcut Fn F1 to activate this mode Recover by pressing any keyboard key except Fn NOTE The power indicator will blink in this mode Power Management Modes The Notebook PC has a number of automatic or adjust...

Page 30: ...el ON and OFF On certain models stretches the screen area to fill the entire display when using low resolution modes LCD MonitorIcons F8 TogglesbetweentheNotebookPC sLCDdisplayandan externalmonitorinthisseries NotebookPCLCD ExternalMonitor Both This functiondoesnotworkin256Colors selectHighColorinDisplayPropertySettings NOTE Must connect an external monitor before booting up Radio Tower F2 Wireles...

Page 31: ...ace Bar This key toggles power savings between various power sav ing modes The power saving modes control many aspects of the Notebook PC to maximize performance versus battery time Applying or removing the power adapter will automatically switch the system between AC mode and battery mode You can see the current mode through the on screen display OSD Fn C Toggles Splendid Video Intelligent Techno...

Page 32: ... located at the upper right hand corner of each key as shown in the figure When the numeric keypad is engaged by pressing Fn Ins Num LK the number lock LED lights up If an external keyboard is connected pressing the Ins Num LK on the external keyboard enables disables the NumLock on both keyboards simultaneously Todisablethenumerickeypadwhilekeepingthekeypad on an external keyboard activated press...

Page 33: ...er4Gear eXtreme Key Pressing this button will launch Express Gate when the Notebook PC is powered off Refer to the Express Gate User s Manual for details The Power4Gear eXtreme key toggles power savings between various power saving modes The power saving modes control many aspects of the Notebook PC to maximize performance versus battery time Applying or removing the power adapter will automatical...

Page 34: ... OFF or in the Suspend to Disk Hibernation mode Wireless LAN Indicator This is only applicable on models with built in wireless LAN When the built in wireless LAN is enabled this indicator will light Windows software settings are necessary Drive Activity Indicator Indicates that the Notebook PC is accessing one or more storage device s such as the hard disk The light flashes proportional to the ac...

Page 35: ...creases the audio volume Fn Up Speaker Icon F12 Increases the audio volume Multimedia Control Keys on selected models The multimedia control keys allows for convenient controlling of the multimedia application The fol lowing defines the meaning of each multimedia control key on the Notebook PC CD Skip to Previous Track Rewind Audio Volume Down During CD play this button has two functions Track The...

Page 36: ...36 3 Getting Started ...

Page 37: ...ls Trusted Platform Module TPM on selected models Trusted Platform Module TPM on selected models Fingerprint Registration on selected models 3G Watcher on selected models and in selected territories Photos and icons in this manual are used for artistic purposes only and do not show what is actually used in the product itself There may be differences between your Notebook PC and the drawings shown ...

Page 38: ...e touchpad Because the touchpad is electrostatic sensitive objects cannot be used in place of your fingers The touchpad s primary function is to move the pointer around or select items displayed on the screen with the use of your fingertip instead of a standard desktop mouse The following illustrations demonstrate proper use of the touchpad Moving The Pointer Place your finger in the center of the...

Page 39: ...icking Tapping With the pointer over an item press the left button or use your fingertip to touch the touchpad lightly keeping your finger on the touchpad until the item is selected The selected item will change color The following 2 examples produce the same results Clicking Tapping Double Clicking Double Tapping Touchpad Usage Illustrations Dragging Dragging means to pick up an item and place it...

Page 40: ...s or grease Do not touch the touchpad if your fingers are dirty or wet Do not rest heavy objects on the touchpad or the touchpad buttons Do not scratch the touchpad with your finger nails or any hard objects Automatic Touchpad Disabling Windows can automatically disable the Notebook PC s touchpad when an external USB mouse is at tached This feature is normally OFF to turn ON this feature select th...

Page 41: ...ds Inserting an Expansion Card Be sure the ExpressCard is level when inserting 1 If there is an ExpressCard socket protector remove it using the Removing an Express Card instructions below 2 Insert the ExpressCard with the connector side first and label side up Standard ExpressCards will be flush with the Notebook PC when fully inserted 3 Carefully connect any cables or adapters needed by the Expr...

Page 42: ...re no obstructions that may get jammed under the drive s tray 3 Hold the disc by the edge and face the disc s printed side up Push down on both sides of the disc s center until the disc snaps onto the hub The hub should be higher than the disc when correctly mounted 4 Slowly push the drive s tray back in The drive will begin reading the table of contents TOC on the disc When the drive stops the di...

Page 43: ...D print To decrease vibration use the Notebook PC on an even surface and do not place labels on the CD Listening to Audio CD The optical drives can play audio CDs but only the DVD ROM drive can play DVD audio Insert the audio CD and Windows automatically opens an audio player and begins playing Depending on the DVD audio disc and installed software it may require that you open a DVD player to list...

Page 44: ... from devices such as digital cameras MP3 players mobile phones and PDAs This Notebook PC has a single built in memory card reader that can use many flash memory cards as shown in the example below The built in memory card reader is not only convenient but also faster than most other forms of memory card readers because it utilizes the internal high bandwidth PCI bus WARNING To prevent data loss u...

Page 45: ...acing or upgrading the hard drive always visit an authorized service center or retailer for this Notebook PC IMPORTANT Poor handling of the Notebook PC may damage the hard disk drive Handle the Notebook PC gently and keep it away from static electricity and strong vibrations or impact The hard disk drive is the most delicate component and will likely be the first or only component that is damaged ...

Page 46: ... to ensure maximum compatibility and reliability The BIOS automatically detects the amount of memory in the system and configures CMOS accordingly during the POST Power On Self Test process There is no hardware or software including BIOS setup required after the memory is installed This is only an example WARNING Disconnect all the con nected peripherals any telephone or telecommunication lines an...

Page 47: ... 1000 BASE T hub not a BASE T4 hub For 10Base T use category 3 4 or 5 twisted pair wiring 10 100 Mbps Full Duplex is supported on this Notebook PC but requires connection to a network switching hub with duplex enabled The software default is to use the fastest setting so no user intervention is required 1000BASE T or Gigabit is only supported on selected models Twisted Pair Cable The cable used to...

Page 48: ...exibility on your existing or future wireless network configurations for distances up to 40 meters between the client and the access point To provide efficient security to your wireless communication the optional built in wireless LAN comes with a 64 bit 128 bit Wired Equivalent Privacy WEP encryption and Wi Fi Protected Access WPA features Ad hoc mode TheAd hoc mode allows the Notebook PC to conn...

Page 49: ...etwork icon 5 Select Show Wireless if you have many networks in your area 6 Select the wireless network you want to connect to 7 When connecting you may have to enter a password 8 After connection has been established Connected will be shown 2b Or double click the Wireless Console icon in the Notification area and select either the Wireless LAN Bluetooth or just the Blue tooth 1 Switch ON the Wire...

Page 50: ...ect to the Internet You may also use it for SMS messaging Bluetooth enabled computers or PDAs You can wireless connect to another computer or PDA and exchange files share peripherals or share Internet or network connections You may also make use of Bluetooth enabled wireless keyboard or mouse 2b Or double click the Wireless Console icon in the Notification area and select either the Wireless LAN B...

Page 51: ...tiveness Each individual TPM must have an Owner before it is useful as a security device TPM Applications TPM is useful for any customer that is interested in providing an addition layer of security to the com puter system The TPM when bundled with an optional security software package can provide overall system security file protection capabilities and protect against email privacy concerns TPM h...

Page 52: ...u how to setup the fingerprint registration 1 This wizard will automatically start whenTPM is enabled in BIOS see Appendix Click Next 2 Select Fingerprints and click Next 3 Select a finger on the diagram Swipe the corresponding finger on the scanner slowly You must swipe your finger multiple times for verification 4 Youmustregisteratleasttwofingerstodecrease the chance of problems ...

Page 53: ...your finger multiple times for verification Youmustregisteratleasttwofingers to decrease the chance of any problems 6 Click Finish when done Fingerprint Registration on selected models cont 7 Right click the icon on the taskbar and select Settings and Options 8 Select General Options and Single Sign On and configure your preferences ...

Page 54: ...ill be asked if you have set one Once your PIN has been verified searching for a 3G network will begin Once a 3G network has been discovered click Connect to make a wireless network connection Once connected the Connect button will show Disconnect instead Once connected a message will appear with the network name When you are in an area that prohibits wireless transmissions such as on an airplane ...

Page 55: ...e pointer over this indicator shows the RSSI Received Signal Strength Indication in dBm An antenna with a line through it indicates no service is available Not in Service You are outside of the coverage area or have insufficient signal strength to maintain a GSM data connection Coverage The icon shows the fastest service available GPRS icon GPRS is the fastest service available in your current cov...

Page 56: ...r is running the Watcher icon appears in the system tray indicating the connection status Watcher cannot detect the 3G modem Ensure that the 3G modem is powered on You do not have an active high speed connection You have an active high speed connection You have new unread SMS messages 3G or 3 G Short for third generation technology It is used in the context of mobile phone standards The services a...

Page 57: ...re Recovery Glossary Declarations and Safety Statements Notebook PC Information Photos and icons in this manual are used for artistic purposes only and do not show what is actually used in the product itself There may be differences between your Notebook PC and the drawings shown in this manual Please accept your Notebook PC as being correct ...

Page 58: ... systems no drivers are necessary USB Hub Optional Attaching an optional USB hub will increase your USB ports and allow you to quickly connect or disconnect many USB peripherals through a single cable USB Floppy Disk Drive An optional USB interface floppy disk drive can accept a standard 1 44MB or 720KB 3 5 inch floppy diskette WARNING To prevent system failures use Windows Safely Remove Hardware ...

Page 59: ...ard will allow data entry to be more comfortable Attaching an external USB mouse will allow Windows navigation to be more comfortable Both the external USB keyboard and mouse will work simultaneously with the Notebook PC s built in keyboard and touchpad Printer Connection One or more USB printers can be simultaneously used on any USB port or USB hub ...

Page 60: ...oth devices in Windows operating system 3 Select Add a Bluetooth Device on the taskbar menu 3c If launched from the Control Panel click Add from this screen 3b Or Launch Bluetooth Devices from the Windows Control Panel 2b Or double click the Wireless Console icon on the taskbar and select either the Wireless LAN Bluetooth or just the Bluetooth 2 Press FN F2 repeatedly until Bluetooth ON or WLAN Bl...

Page 61: ...t of nearby Bluetooth devices will be shown Select the Bluetooth mouse and click Next 7 Select Don t use a passkey and click Next 9 Click Finish when adding is complete 10 You will see your device in the window You can also add or remove Bluetooth devices here 8 Wait while the Bluetooth mouse is being added Bluetooth Mouse Setup optional cont ...

Page 62: ...luded as part of the factory pre install A recovery disc is optional and includes an image of the original operating system installed on the hard drive at the factory The recovery disc provides a comprehensive recovery solution that quickly restores the Notebook PC s operating system to its original working state provided that your hard disk drive is in good working order Contact your retailer if ...

Page 63: ...reen select Boot Device Priority Security Setting 1 On the Security screen select Change Supervisor or Change User Password 2 Type in a password and press Enter 3 Re type the password and press Enter 4 Password is then set 1 Leave the password field blank and press Enter To clear the password 2 Password is then cleared ...

Page 64: ... to allow the User Password to have in the BIOS setup utility User Access Level Save Changes If you want to keep your configuration settings you must save changes before exiting the BIOS setup utility If you want to restore default settings choose Load Manufacture Defaults You must then save changes to keep the manufacture default settings System BIOS Settings cont ...

Page 65: ...the ATK0100 driver from the driver CD or download it from the ASUS website Hardware Problem Built in Camera The built in camera does not work correctly 1 Check Device Manager to see if there are any problems 2 Try reinstalling the webcam driver to solve the problem 3 If the problem is not solved update the BIOS to the latest version and try again 4 If the problem still exist contact your local ser...

Page 66: ...a local service center for repair Mechanical Problem FAN Thermal Why is the cooling fan always ON and the temperature high 1 Make sure that the FAN works when the CPU temperature is high and check whether there is air flow from the main air vent 2 If you have many applications running see taskbar close them to decrease system load 3 The problem may also be caused by some viruses use anti virus sof...

Page 67: ...ll them in Windows Safe Mode 3 Check your system for viruses 4 Update the BIOS to the latest version with WINFLASH in Windows orAFLASH in DOS mode These utilities and BIOS files can be downloaded from the ASUS website WARNING Make sure your Notebook PC does not loose power during the BIOS flashing process 5 If problem still cannot be solved use the recovery process to reinstall your entire system ...

Page 68: ...elected BIOS information Check the model version and data c Click Flash to initialize the BIOS updating procedure d Click Exit when procedure completes e Reboot the system Assuming that you have successfully flashed the BIOS file press F2 to enter BIOS setup page when the ASUS logo appears during system boot up f After entering BIOS setup page go to Exit page and choose Load Manufacture Defaults T...

Page 69: ...cking on the NIS icon in your system tray 2 Open Norton AntiVirus in Options menu 3 Click on Instant Messenger uncheck MSN Windows Messenger from Which Instant mes sengers to protect 5 NIS is damaged and need reinstalling NIS is located in the provided disc in the NIS200x folder x is the version number 6 The Start firewall when system is booted option is selected but it takes about one minute to s...

Page 70: ...ms and Solutions Cont 9 Windows Firewall must be stopped before installing Norton Internet Security or Norton Personal Firewall How to stop Windows Firewall 1 Click Start and then Control Panel 2 You will have one of two control panels Click on the Security Center icon 3 Click on the Windows Firewall icon beneath the status updates 4 Click Off and then click OK 10 Why is the Privacy Control icon s...

Page 71: ...amed RE COVERY The Recovery Partition is created at the fac tory and cannot be restored by the user if deleted Take your Notebook PC to an authorizedASUS service center if you have problems with the recovery process Using the Recovery Partition 1 Press F9 during bootup requires a Recovery Partition 2 Press Enter to select Windows Setup EMS Enabled 3 Read the ASUS Preload Wizard screen and click Ne...

Page 72: ...com kb 937251 en us for more details Using the Recovery DVD 1 Insert the Recovery DVD into the optical drive Notebook PC needs to be powered ON 2 Restart the Notebook PC and press Esc on bootup and select the optical drive may be labeled as CD DVD using the down cursor and press Enter to boot from the Recovery DVD 3 Select a partition option and click Next Partition options Recover Windows to firs...

Page 73: ...ter transfers data between computer components such as memory disks and the display adapter The BIOS instructions are built into the computer s read only memory BIOS parameters can be configured by the user through the BIOS Setup program The BIOS can be updated using the provided utility to copy a new BIOS file into the EEPROM Bit Binary Digit Represents the smallest unit of data used by the compu...

Page 74: ...he slower parallel bus used in the PC card slot Not compatible with previous PCMCIA cards Hardware Hardware is a general term referring to the physical components of a computer system including pe ripherals such as printers modems and pointing devices IDE Integrated Drive Electronics IDE devices integrate the drive control circuitry directly on the drive itself eliminating the need for a separate ...

Page 75: ...zardous diffuse reflections Personnel working with these lasers should wear appropriate protective eye wear during any operation of the laser Class 3B lasers have both admin istrative and physical controls to protect personnel Physical controls include limited access work areas Administrative controls include special warning signs posted outside the entrances to the laser work spaces and lights ou...

Page 76: ...ta The TPM provides the ability to the PC or Notebook PC to run applications more secure and to make transactions and communication more trustworthy Twisted Pair Cable The cable used to connect the Ethernet card to a host generally a Hub or Switch is called a straight through Twisted Pair Ethernet TPE The end connectors are called RJ 45 connectors which are not compatible with RJ 11 telephone conn...

Page 77: ...quire that all DVD movies be limited to a particular region usually coded to the region at which it is sold While DVD movie content may be released for multiple regions CSS design rules require that any system capable of playing CSS encrypted content must only be capable of playing one region Region Definitions Region 1 Canada US US Territories Region 2 Czech Egypt Finland France Germany Gulf Stat...

Page 78: ...g if provided is by means of dual tone multifrequency signalling Network Compatibility Declaration Statement to be made by the manufacturer to the Notified Body and the vendor This declaration will indicate the networks with which the equipment is designed to work and any notified networks with which the equipment may have inter working difficulties Network Compatibility Declaration Statement to b...

Page 79: ... Yes Norway Yes No Poland No Not Applicable Portugal No Not Applicable Spain No Not Applicable Sweden Yes No Switzerland Yes No United Kingdom Yes No This information was copied from CETECOM and is supplied without liability For updates to this table you may visit http www cetecom de technologies ctr_21 html 1 National requirements will apply only if the equipment may use pulse dialling manufactur...

Page 80: ...Connect the equipment into an outlet on a circuit different from that to which the receiver is connected Consult the dealer or an experienced radio TV technician for help WARNING The use of a shielded type power cord is required in order to meet FCC emission limits and to prevent interference to the nearby radio and television recep tion It is essential that only the supplied power cord be used Us...

Page 81: ...ration within 5 15 GHz and 5 25GHz frequency ranges and is restricted to indoor environments only FCC Caution Any changes or modifications not expressly approved by the party re sponsible for compliance could void the user s authority to operate this equipment The manufacturer declares that this device is limited to Channels 1 through 11 in the 2 4GHz frequency by specified firmware controlled in ...

Page 82: ...tments in which the use of the 2400 2483 5 MHz band is permitted with an EIRP of less than 100mW indoors and less than 10mW outdoors 01 Ain Orientales 02 Aisne 03 Allier 05 Hautes Alpes 08 Ardennes 09 Ariège 11 Aude 12 Aveyron 16 Charente 24 Dordogne 25 Doubs 26 Drôme 32 Gers 36 Indre 37 Indre et Loire 41 Loir et Cher 45 Loiret 50 Manche 55 Meuse 58 Nièvre 59 Nord 60 Oise 61 Orne 63 Puy du Dôme 64...

Page 83: ...red for UL1642 covering primary non rechargeable and secondary rechargeable lithium batter ies for use as power sources in products These batteries contain metallic lithium or a lithium alloy or a lithium ion and may consist of a single electrochemical cell or two or more cells connected in series parallel or both that convert chemical energy into electrical energy by an irreversible or reversible...

Page 84: ...ded product lifetime through easy up grades and longer time availability of spare parts 6 Reduced solid waste through take back policy For more information on the EU Flower label please visit the European Union Eco label Hompage http europa eu int ecolabel ASUS recycling and takeback programs come from our commitment to the highest standards for protecting our environment We believe in providing s...

Page 85: ...new products And the environment is protected from any uncontrolled release of harmful chemicals ASUS works with recycling vendors with the highest standards for protecting our environment ensuring worker safety and complying with global environmental laws Our commitment to recycling our old equipment grows out of our work to protect the environment in many ways For further information about ASUS ...

Page 86: ... tilbage til leverandøren Danish VARNING Explosionsfara vid felaktigt batteribyte Använd samma batterityp eller en ekvivalent typ som rekommenderas av apparattillverkaren Kassera använt batteri enligt fabrikantens instruktion Swedish VAROITUS Paristo voi räjähtää jos se on virheellisesti asennettu Vaihda paristo aino astaanlaitevalmistajansousittelemaantyyppiin Hävitäkäytettyparistovalmistaganohje...

Page 87: ...regulations for laser products on August 2 1976 These regulations apply to laser products manu factured from August 1 1976 Compliance is mandatory for products marketed in the United States Macrovision Corporation Product Notice This product incorporates copyright protection technology that is protected by method claims of certain U S A patents and other intellectual property rights owned by Macro...

Page 88: ...A Appendix A 32 CTR 21 Approval for Notebook PC with built in Modem Danish Dutch English Finnish French German Greek Italian Portuguese Spanish Swedish ...

Page 89: ...Appendix A A 33 ...

Page 90: ...r ______________________________ Type _______________ BIOS Version _ __________________________________________Date _______________ Accessories _ _____________________________________________________________ Accessories _ _____________________________________________________________ Software Operating System _ __________Version _ ___________ Serial Number _______________ Software _ _______________...

Page 91: ...LD NOT BE CONSTRUEDASACOMMITMENT BYASUS ASUSASSUMES NO RESPONSIBILITYOR LIABILITYFORANYERRORS OR INACCURACIES THAT MAYAPPEAR IN THIS MANUAL INCLUDING THE PRODUCTS AND SOFTWARE DESCRIBED IN IT Copyright 2008 ASUSTeK COMPUTER INC All Rights Reserved Limitation of Liability Circumstances may arise where because of a default on ASUS part or other liability you are entitled to recover damages from ASUS...

Reviews: